Selected: IGF-1 LR3 · 1 MG. Product artwork shows your selected size. Refer to the batch documentation for lot-specific results.
Research material
IGF-1 LR3.
For research use only
An extended IGF-1 analog with an Arg3 substitution.
Lyophilized powder in a sealed vial. View COA
$85.00 per vial
This size is currently sold out.
Typically dispatched within 1–2 business days after your payment is confirmed.
US shipping: $15 flat, free on orders of $300+ →
Pay by Zelle, USDC on Base or Bitcoin after you order and save 5% · How payment works →
Certificate of analysis1 MG · Report pending
The lot report for this size is in preparation. Contact us for documentation status. A report in preparation is not a test result.
Browse the COA library Ask about documentation01 / The essentials
Know your material.
IGF-1 LR3 is a modified insulin-like growth factor 1 analog. Its LR3 designation identifies a distinct research material rather than unmodified IGF-1. Supplied in a 1mg vial.
For laboratory research use only. Not for human consumption.
| Compound | IGF-1 LR3 |
|---|---|
| Also known as | Long Arg3 IGF-I · Long R3 IGF-I |
| Sizes | 1 MG (sold out) |
| Physical form | Lyophilized powder |
| Format | Sealed vial |
| Storage | Lyophilized powder at −20°C; protect from light and moisture |
| Lot report | Report pending |
| Class | IGF-I analog protein with three disulfide bonds |
| Length | 83 amino acids |
| Sequence | MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA |
| CAS number | 143045-27-6 |
| FDA substance record | UNII M9L22Y19H9 |
Reference values from public records, not a Pioneer lot specification.
The details, before you order
FAQ.
Is IGF-1 LR3 for human or veterinary use?
No. Pioneer Labs supplies IGF-1 LR3 for laboratory research use only. It is not for human consumption or veterinary use.
What’s in the vial?
The selected size is the amount of material per vial. Quantity is the number of vials. Each is presented as lyophilized powder in a sealed vial.
How do I find my batch report?
Match the batch number printed on your vial to its laboratory report. Current and superseded records are available in the certificate library when published.
Browse the COA library How to read a COAHandling & storage
Lyophilized material: Store at −20°C; protect from light and moisture.
Follow the material-specific label and supporting storage documentation. These temperatures do not establish a shelf life.
How to store lyophilized peptidesAsk about this materialWhen is my order dispatched?
Typically within 1–2 business days after your payment is confirmed. We ship to all 50 states + DC: $15 flat, free on orders of $300+. Working to a deadline? Contact our team before you order.
Shipping information Return termsDo I need an account to order?
Yes. Every order is placed from a Pioneer Labs account.
How do I pay?
After you place your order, pay by Zelle, USDC on Base or Bitcoin and save 5%.
How payment worksA size is sold out. Can I hear when it’s back?
Yes. Choose the size, select Request restock, and we’ll email you when it returns.
Have more questions?Contact our team
Pioneer / Research notesIGF-1 LR3Inside the molecule
02 / Go a little deeper
A closer look.
Explore the molecular architecture, research references, and the details that distinguish IGF-1 LR3.
Read the IGF-1 LR3 structure guideRelated research materials.
View all materials →
